Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Pre T-cell antigen receptor alpha(Ptcra)

Recombinant Rat Pre T-cell antigen receptor alpha(Ptcra)

SKU:CSB-CF018961RA

Regular price ¥268,900 JPY
Regular price Sale price ¥268,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P0C6B3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LPSGIAGTPFPSLAPPVTLLVDGRRHTLVVCLVLDAAPPGLDSLVWFSGGNGSALDAFTYGPSPAPDGTWTSLGQLSLSSEELEAWEPLVCHTRPAAGGLNRSTHPLQLSGEEASTDRTCPQETLRGTQRQVLRLSVLRLLLFKLLLLDVFLTCSRLCVLAGQHLLPPPSSKQAPASTHQSWT

Protein Names:Recommended name: Pre T-cell antigen receptor alpha Short name= pT-alpha Short name= pTa Alternative name(s): pT-alpha-TCR

Gene Names:Name:Ptcra

Expression Region:17-199

Sequence Info:full length protein

View full details