
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:O70597
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKAGKEAVVTKLKNLETSVSTGRKWFR LGNVLHAIQATEQSIQATDLVPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGINREKWQ MRAARHYYYFLLLSLVRDLYEVLLHMGQVARDRAKREKSSGDPPKYSVANEESEWLQSFL LLLFQSLKRNPPLFLDTVKNFCDILIPLNQLGIYKSNLGVVGFGGLVSSVAGLITVVYPQ LKLKAR
Protein Names:Recommended name: Peroxisomal membrane protein 11A Alternative name(s): 28 kDa peroxisomal integral membrane protein Short name= PMP28 Peroxin-11A Peroxisomal biogenesis factor 11A Peroxisomal coatomer receptor Peroxisomal m
Gene Names:Name:Pex11a Synonyms:Pex11
Expression Region:1-246
Sequence Info:Full length protein
You may also like
-
Recombinant Human Peroxisomal membrane protein 11A(PEX11A)
- Regular price
- ¥183,500 JPY
- Sale price
- ¥183,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine Peroxisomal membrane protein 11A(PEX11A)
- Regular price
- ¥183,500 JPY
- Sale price
- ¥183,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Peroxisomal membrane protein 11C(Pex11g)
- Regular price
- ¥182,700 JPY
- Sale price
- ¥182,700 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Peroxisomal membrane protein 11B(PEX11B)
- Regular price
- ¥184,900 JPY
- Sale price
- ¥184,900 JPY
- Regular price
-
- Unit price
- per
Sold out