Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat N-acetyltransferase 8(Nat8)

Recombinant Rat N-acetyltransferase 8(Nat8)

SKU:CSB-CF879445RA

Regular price ¥273,800 JPY
Regular price Sale price ¥273,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q9QXT3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MASFHIRQFQERDYEQVVDMFSRGMKEHIPTAFRHLLLLPRTLLLLLGVPLALVLVSGSW LLAVVCIFFLLPFLWFLAGQPWKNYVSKCLHTDMADITKSYLSDRGSGFWVAESGGQIVG TVGALPVKDPPSGRKQLQLFRLSVSSQHRGQGIAKALVRTVLQFARDQGYTDVVLVTGLL QQGAVTLYYSMGFQKTGESFMDILTWLVDVSLIHFIYPLPSS

Protein Names:Recommended name: N-acetyltransferase 8 EC= 2.3.1.- Alternative name(s): Camello-like protein 4

Gene Names:Name:Nat8 Synonyms:Cml4

Expression Region:1-222

Sequence Info:full length protein

View full details