Recombinant Rat Interleukin-2 receptor subunit alpha(Il2ra)

SKU: CSB-CF011649RA

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P26897

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:ELCLYDPPEVPNATFKALSYKNGTILNCECKRGFRRLNELVYMACLGNSWSNNCQCTSNSHDNSREQVTPQPEGQKEQQTTDTQKSTQSVYQENLAGHCREPPPWRHEDTKRIYHFVEGQIVLYTCIQGYKALQRGPAISICKTVCGEIRWTHPQLTCVDEKEHHQFLASEESQGSRNSFPESEASCPTPNTDFSQLTEATTTMETFVFTKEYQVAVASCIFLLLSILLLSGFTWQHRWRKSRRTI

Protein Names:Recommended name: Interleukin-2 receptor subunit alpha Short name= IL-2 receptor subunit alpha Short name= IL-2-RA Short name= IL-2R subunit alpha Short name= IL2-RA Alternative name(s): CD_antigen= CD25

Gene Names:Name:Il2ra

Expression Region:22-267

Sequence Info:full length protein