Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Glycosyltransferase 6 domain-containing protein 1(Glt6d1)

Recombinant Rat Glycosyltransferase 6 domain-containing protein 1(Glt6d1)

SKU:CSB-CF009534RA

Regular price ¥297,400 JPY
Regular price Sale price ¥297,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:D3ZNQ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKAKGRILLLTSCLFLLLLLLAKIHLRNHQEEELPLSDWFDPRRRLDVITTTDWLAPVIWEGTFDRKVLEKYYHKQNITMGLTVFAVSSFNGQYLDPFLQSASKFFMPGYRVIFYIMVDKSLKLPEMGHNPLQSFQVLVVSQERQWSDFDLMRMTVLSKHIREHIRFEVDFLFVMSVNMVFQNVFGVETLSTSVAQLHAWWYFRKTTHLPYERRPTSAAYIPFGLGDFYYAGAIIGGVPFQVLDFTHQYLKSVILDIENGVNSTYEKYLNKYFFLNKPTKLLSPEYSWDQTFNIPQQVHYVKVAHYPTDDL

Protein Names:Recommended name: Glycosyltransferase 6 domain-containing protein 1 EC= 2.4.1.-

Gene Names:Name:Glt6d1

Expression Region:1-311

Sequence Info:full length protein

View full details