Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial

Recombinant Rat Glucagon-like peptide 1 receptor(Glp1r),partial

SKU:CSB-EP009514RA1-GB

Regular price ¥190,400 JPY
Regular price Sale price ¥190,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Neuroscience

Uniprot ID: P32301

Gene Names: Glp1r

Organism: Rattus norvegicus (Rat)

AA Sequence: GPRPQGATVSLSETVQKWREYRHQCQRFLTEAPLLATGLFCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGIWLHKDNSSLPWRDLSECEESKQGERN

Expression Region: 22-135aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 17.1 kDa

Alternative Name(s): Short name: GLP-1 receptor Short name: GLP-1-R Short name: GLP-1R

Relevance: This is a receptor for glucagon-like peptide 1. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase.

Reference: "Molecular cloning of a cDNA encoding for the GLP-1 receptor expressed in rat lung."Lankat-Buttgereit B., Goke R., Fehmann H.C., Richter G., Goke B.Exp. Clin. Endocrinol. 102:341-347(1994)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details