Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Coiled-coil domain-containing protein 90B, mitochondrial(Ccdc90b)

Recombinant Rat Coiled-coil domain-containing protein 90B, mitochondrial(Ccdc90b)

SKU:CSB-CF706304RA

Regular price ¥278,900 JPY
Regular price Sale price ¥278,900 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:Q4V897

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:DYDRRPVEITPLEQRKLTFDTHALVQDLETHGFDKGQAQTIVSVLSTLSNVSLDTVYKEM VTKAQQEITIQQLMAHLDSIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLINETSRI RADNRLDINLERSRVTDMFTDQEKQLMEATNEFTKKDMQTKSIISETSNKIDTEIASLKT LMESSKLETIRYLAASVFTCLAIALGFYRFWKEN

Protein Names:Recommended name: Coiled-coil domain-containing protein 90B, mitochondrial

Gene Names:Name:Ccdc90b

Expression Region:43-256

Sequence Info:full length protein

View full details