Recombinant Rat CMRF35-like molecule 1(Cd300lf),Partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rat CMRF35-like molecule 1(Cd300lf),Partial

CSB-EP707077RA
Regular price
¥158,000 JPY
Sale price
¥158,000 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Others

Uniprot ID: Q566E6

Gene Names: Cd300lf

Organism: Rattus norvegicus (Rat)

AA Sequence: AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS

Expression Region: 19-181aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

MW: 38.3 kDa

Alternative Name(s): CD300 antigen-like family member F CD_antigen: CD300f

Relevance: Acts as an inhibitory receptor for myeloid cells and mast cells. Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis. Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands. May act as a coreceptor for interleukin 4 (IL-4). Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling. Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2. Inhibits osteoclast formation. Induces macrophage cell death upon engagement.

Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human CMRF35-like molecule 1(CD300LF),partial
    Regular price
    ¥117,400 JPY
    Sale price
    ¥117,400 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human CMRF35-like molecule 1(CD300LF),partial
    Regular price
    ¥105,100 JPY
    Sale price
    ¥105,100 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse CMRF35-like molecule 6(Cd300c)
    Regular price
    ¥230,500 JPY
    Sale price
    ¥230,500 JPY
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rat CMRF35-like molecule 8(Cd300a)
    Regular price
    ¥242,400 JPY
    Sale price
    ¥242,400 JPY
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share