
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q566E6
Gene Names: Cd300lf
Organism: Rattus norvegicus (Rat)
AA Sequence: AQDPVTGPEEVSGYEQGSLTVWCRYGSWWKDYSKYWCRGPKRSSCEIRVETDASERLVKENHVSIRDDQTNFTFTVTMEDLRMSDAGIYWCGITKAGYDHMFKVHVSINPVPTTPTTTSTTTIFTVTTTVKETSTLSTQTSHYSDNRYDSGGVGDGNGFLDLS
Expression Region: 19-181aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 38.3 kDa
Alternative Name(s): CD300 antigen-like family member F CD_antigen: CD300f
Relevance: Acts as an inhibitory receptor for myeloid cells and mast cells. Positively regulates the phagocytosis of apoptotic cells (efferocytosis) via phosphatidylserine (PS) recognition; recognizes and binds PS as a ligand which is expressed on the surface of apoptotic cells. Plays an important role in the maintenance of immune homeostasis, by promoting macrophage-mediated efferocytosis and by inhibiting dendritic cell-mediated efferocytosis. Negatively regulates Fc epsilon receptor-dependent mast cell activation and allergic responses via binding to ceramide and sphingomyelin which act as ligands. May act as a coreceptor for interleukin 4 (IL-4). Associates with and regulates IL-4 receptor alpha-mediated responses by augmenting IL-4- and IL-13-induced signaling. Negatively regulates the Toll-like receptor (TLR) signaling mediated by MYD88 and TRIF through activation of PTPN6/SHP-1 and PTPN11/SHP-2. Inhibits osteoclast formation. Induces macrophage cell death upon engagement.
Reference: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human CMRF35-like molecule 1(CD300LF),partial
- Regular price
- ¥117,400 JPY
- Sale price
- ¥117,400 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CMRF35-like molecule 1(CD300LF),partial
- Regular price
- ¥105,100 JPY
- Sale price
- ¥105,100 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse CMRF35-like molecule 6(Cd300c)
- Regular price
- ¥230,500 JPY
- Sale price
- ¥230,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat CMRF35-like molecule 8(Cd300a)
- Regular price
- ¥242,400 JPY
- Sale price
- ¥242,400 JPY
- Regular price
-
- Unit price
- per
Sold out