Recombinant Rat CDGSH iron-sulfur domain-containing protein 1(Cisd1)

SKU: CSB-CF005442RA

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:B0K020

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GLSSDSPVRVEWIAAVTFAAGTAALGYLAYKKFYAKESRTKAMVNLQIQKDNPKVVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET

Protein Names:Recommended name: CDGSH iron-sulfur domain-containing protein 1 Alternative name(s): MitoNEET

Gene Names:Name:Cisd1

Expression Region:2-108

Sequence Info:full length protein