Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat C-type lectin domain family 9 member A(Clec9a)

Recombinant Rat C-type lectin domain family 9 member A(Clec9a)

SKU:CSB-CF005542RA

Regular price ¥284,000 JPY
Regular price Sale price ¥284,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:D4AD02

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MHEEEIYTSLQWDIPTSEASQKCPSLSKCPGTWCIVTVISCVVCVGLLAASIFLGIKFSQVSSLVMEQRERLIRQDTALLNLTEWQRNHTLQLKSCQASLQRSLRSGSNCNPCPPNWIQNGKSCYYAFDRWETWNNSKKSCLKEGDSLLQIDSKEEMEFINLSIWKLKGGYEYWVGVFQDGPSGSWFWEDGSSPLSDLLPTDRQLSASQICGYLKDHTLISDNCSNWKYFICEKKAFGSCI

Protein Names:Recommended name: C-type lectin domain family 9 member A

Gene Names:Name:Clec9a

Expression Region:1-241

Sequence Info:full length protein

View full details