Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Beta-synuclein(Sncb)

Recombinant Rat Beta-synuclein(Sncb)

SKU:CSB-EP717413RA

Regular price ¥146,000 JPY
Regular price Sale price ¥146,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Neuroscience

Uniprot ID:Q63754

Gene Names:Sncb

Organism:Rattus norvegicus (Rat)

AA Sequence:MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTKEGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKKEEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDSPQEEYQEYEPEAKGP

Expression Region:1-137aa

Sequence Info:Full Length

Source:E.coli

Tag Info:N-terminal 10xHis-tagged

MW:20.5 kDa

Alternative Name(s):Beta-synuclein(Phosphoneuroprotein 14)(PNP 14)

Relevance:May be involved in neuronal plasticity.

Reference:"Leucine-rich repeat kinase 2 binds to neuronal vesicles through protein interactions mediated by its C-terminal WD40 domain." Piccoli G., Onofri F., Cirnaru M.D., Kaiser C.J., Jagtap P., Kastenmuller A., Pischedda F., Marte A., von Zweydorf F., Vogt A., Giesert F., Pan L., Antonucci F., Kiel C., Zhang M., Weinkauf S., Sattler M., Sala C. , Matteoli M., Ueffing M., Gloeckner C.J. Mol. Cell. Biol. 34:2147-2161(2014)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

View full details