Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Beta-galactoside alpha-2,6-sialyltransferase 1(St6gal1)

Recombinant Rat Beta-galactoside alpha-2,6-sialyltransferase 1(St6gal1)

SKU:CSB-CF022759RA

Regular price ¥309,700 JPY
Regular price Sale price ¥309,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P13721

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MIHTNLKKKFSLFILVFLLFAVICVWKKGSDYEALTLQAKEFQMPKSQEKVAMGSASQVVFSNSKQDPKEDIPILSYHRVTAKVKPQPSFQVWDKDSTYSKLNPRLLKIWRNYLNMNKYKVSYKGPGPGVKFSVEALRCHLRDHVNVSMIEATDFPFNTTEWEGYLPKENFRTKVGPWQRCAVVSSAGSLKNSQLGREIDNHDAVLRFNGAPTDNFQQDVGSKTTIRLMNSQLVTTEKRFLKDSLYTEGILIVWDPSVYHADIPKWYQKPDYNFFETYKSYRRLNPSQPFYILKPQMPWELWDIIQEISADLIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYHQKFFDSACTMGAYDPLLFEKNMVKHLNEGTDEDIYLFGKATLSGFRNIRC

Protein Names:Recommended name: Beta-galactoside alpha-2,6-sialyltransferase 1 Short name= Alpha 2,6-ST 1 EC= 2.4.99.1 Alternative name(s): CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1 ST6Gal I Short name= ST6GalI Sialyltransferase 1

Gene Names:Name:St6gal1 Synonyms:Siat1

Expression Region:1-403

Sequence Info:full length protein

View full details