Gene Bio Systems
Recombinant Rat Arachidonate 5-lipoxygenase-activating protein(Alox5ap)
Recombinant Rat Arachidonate 5-lipoxygenase-activating protein(Alox5ap)
SKU:CSB-CF001625RA
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Rattus norvegicus (Rat)
Uniprot NO.:P20291
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MDQEAVGNVVLLAIVTLISVVQNAFFAHKVELESKAQSGRSFQRTGTLAFERVYTANQNC VDAYPTFLVVLWTAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL FLFLMSLAGILNHYLIFFFGSDFENYIRTITTTISPLLLIP
Protein Names:Recommended name: Arachidonate 5-lipoxygenase-activating protein Alternative name(s): FLAP MK-886-binding protein
Gene Names:Name:Alox5ap Synonyms:Flap
Expression Region:1-161
Sequence Info:full length protein
