Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Amphiregulin(Areg)

Recombinant Rat Amphiregulin(Areg)

SKU:CSB-CF001986RA

Regular price ¥261,500 JPY
Regular price Sale price ¥261,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P24338

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:VIKPKENKTEGEKSSEKPKRKKKGGKGGKGRRNRKKKKNPCAAKFQNFCIHGECRYIENLEVVTCHCHQDYFGERCGEKTMKTQKKDDSDLSKIALAAIIVFVSAVSVAAIGIITAVLLRKRFFREYEEAEERRRLRQENGTAHAIA

Protein Names:Recommended name: Amphiregulin Short name= ARAlternative name(s): Schwannoma-derived growth factor Short name= SDGF

Gene Names:Name:AregSynonyms:Sdgf

Expression Region:97-243

Sequence Info:full length protein

View full details