Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Activin receptor type-1(Acvr1)

Recombinant Rat Activin receptor type-1(Acvr1)

SKU:CSB-CF001257RA

Regular price ¥325,800 JPY
Regular price Sale price ¥325,800 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P80201

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEDEEPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSVNDGFRVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNVTARLPTKGKSFPGSQNFHLEVGLIILSVVFAVCLFACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLAELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC

Protein Names:Recommended name: Activin receptor type-1 EC= 2.7.11.30 Alternative name(s): Activin receptor type I Short name= ACTR-I Serine/threonine-protein kinase receptor R1 Short name= SKR1 TGF-B superfamily receptor type I Short name= TSR-I

Gene Names:Name:Acvr1 Synonyms:Acvrlk2

Expression Region:21-509

Sequence Info:full length protein

View full details