Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rat Activator of apoptosis harakiri(Hrk)

Recombinant Rat Activator of apoptosis harakiri(Hrk)

SKU:CSB-CF010741RA

Regular price ¥256,400 JPY
Regular price Sale price ¥256,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rattus norvegicus (Rat)

Uniprot NO.:P62817

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MCPCPRHRGRGPPAVCGCGDARPGLRWAAAQVTALRLQALGDELHRRAMRRRARPRDPLP ALLPALRARWPWLCAAAQVAALAAWLLGRRSA

Protein Names:Recommended name: Activator of apoptosis harakiri Alternative name(s): BH3-interacting domain-containing protein 3 Neuronal death protein DP5

Gene Names:Name:Hrk Synonyms:Bid3, Dp5

Expression Region:1-92

Sequence Info:Full length protein

View full details