Skip to product information
1 of 1

Gene Bio Systems

Recombinant Ralstonia solanacearum Probable intracellular septation protein A(RSc1746)

Recombinant Ralstonia solanacearum Probable intracellular septation protein A(RSc1746)

SKU:CSB-CF849041RAR

Regular price ¥271,200 JPY
Regular price Sale price ¥271,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Ralstonia solanacearum (strain GMI1000) (Pseudomonas solanacearum)

Uniprot NO.:Q8XYL2

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKFLFDLFPVILFFAAFKVAGIYVATTVAMVATVAQIAWVWFKHRKVDAMQWLSLLIIVV FGGATLIFHNDTFIKWKPTVLYWMFGVVLLGSAVLLRKNLIRAMMEQQVSLPEPMWGRLN LVWSLFFLAMGGLNLYVAYHFDTDVWVNFKLFGSMGLMVVFILVQSVWLARHMQERPAGA NPQDDR

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:RSc1746 ORF Names:RS02934

Expression Region:1-186

Sequence Info:full length protein

View full details