Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit Potassium-transporting ATPase subunit beta(ATP4B)

Recombinant Rabbit Potassium-transporting ATPase subunit beta(ATP4B)

SKU:CSB-CF002343RB

Regular price ¥288,700 JPY
Regular price Sale price ¥288,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:P18597

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MAALQEKKSCSQRMEEFRHYCWNPDTGQMLGRTLSRWVWISLYYVAFYVVMTGLFALCIYVLMQTIDPYTPDYQDQLKSPGVTLRPDVYGEKGLEIHYNISDNRTWTSLTHTLRSFLAGYSPAAQVDNINCTSKTYFFQESFGAPNHTKFSCKFTADMLENCSGLTDPSFGFKEGKPCFIIKMNRIVRFLPSNSTPPRVDCTFLDMPHQALTPLQVEYYPPNGTFSLHYFPYYGKKAQPHYSNPLVAAKLLNVPTNTEVVVLCKILADHVTFDNPHDPYEGKVEFKLKIQK

Protein Names:Recommended name: Potassium-transporting ATPase subunit beta Alternative name(s): Gastric H(+)/K(+) ATPase subunit beta Proton pump beta chain

Gene Names:Name:ATP4B

Expression Region:1-291

Sequence Info:full length protein

View full details