Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit Cytotoxic T-lymphocyte protein 4(CTLA4)

Recombinant Rabbit Cytotoxic T-lymphocyte protein 4(CTLA4)

SKU:CSB-CF006163RB

Regular price ¥269,600 JPY
Regular price Sale price ¥269,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:P42072

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:KALHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSDFLLWILAAISSGLFFYSFLITAVSLSKMLKKRSPLTTGVYVKMPPTEPECEKQFQPYFIPIN

Protein Names:Recommended name: Cytotoxic T-lymphocyte protein 4 Alternative name(s): Cytotoxic T-lymphocyte-associated antigen 4 Short name= CTLA-4 CD_antigen= CD152

Gene Names:Name:CTLA4

Expression Region:36-223

Sequence Info:full length protein

View full details