Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit C-X-C motif chemokine(CXCL9)

Recombinant Rabbit C-X-C motif chemokine(CXCL9)

SKU:CSB-EP006252RB

Regular price ¥191,000 JPY
Regular price Sale price ¥191,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: U3KNX2

Gene Names: CXCL9

Organism: Oryctolagus cuniculus (Rabbit)

AA Sequence: SPIMRNGRCSCISSTQGKIHLQSLKDLKQFSPSPSCGKTEIIATKKDGTQICLNPDSTEVKELVEKWKKQSSPKKKQKKGKKQRKVKKSLKKSQRPHQKKTA

Expression Region: 23-124aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27.5 kDa

Alternative Name(s):

Relevance:

Reference: "Genome Sequence of Oryctolagus cuniculus (European rabbit)."The Genome Sequencing PlatformDi Palma F., Heiman D., Young S., Gnerre S., Johnson J., Lander E.S., Lindblad-Toh K.Submitted (AUG-2009)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details