Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit Apolipoprotein E(APOE),partial

Recombinant Rabbit Apolipoprotein E(APOE),partial

SKU:CSB-EP001936RBb7

Regular price ¥164,700 JPY
Regular price Sale price ¥164,700 JPY
Sale Sold out
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Cardiovascular

Uniprot ID: P18287

Gene Names: APOE

Organism: Oryctolagus cuniculus (Rabbit)

AA Sequence: TEQEVEVPEQARWKAGQPWELALGRFWDYLRWVQSLSDQVQEELLSSQVTQELTMLMEETMKEVKAYKSELEEQLSPMAQEHRARLSKELQVAGALEADMEDVCNRLAQYRGEAQAMLGQSTEELARAFSSHLRKLRKRLLRDAEDLQKRMAVYGAGAREGAERGVSAVRERLGSRLERGRLRVATVGTLAGRPLRERAQAWGERLRGHLEEVGSRARDRLNEVREQVEEVRVKVEEQAPQMRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKLQAAMPSKAPAAAPIENQ

Expression Region: 20-311aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 10xHis-B2M-tagged and C-terminal Myc-tagged

MW: 50.6 kDa

Alternative Name(s):

Relevance: Mediates the binding, internalization, and catabolism of lipoprotein particles. It can serve as a ligand for the LDL (apo B/E) receptor and for the specific apo-E receptor (chylomicron remnant) of hepatic tissues.

Reference: "Isolation and characterization of a full-length rabbit apolipoprotein E cDNA." Hao Q.L., Yamin T.T., Pan T.C., Chen S.L., Chen B.S., Kroon P.A., Chao Y.S. Atherosclerosis 66:125-130(1987)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

View full details