Skip to product information
1 of 1

Gene Bio Systems

Recombinant Rabbit ADP-ATP translocase 1(SLC25A4)

Recombinant Rabbit ADP-ATP translocase 1(SLC25A4)

SKU:CSB-CF021510RB

Regular price ¥294,300 JPY
Regular price Sale price ¥294,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Oryctolagus cuniculus (Rabbit)

Uniprot NO.:O46373

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SDQALSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVRI PKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKGAAQREFSGLGNCLTKIFKSDGLRGLYQGFNVSV QGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQTVTAVAGLVSYPFDTVRRRMMMQ SGRKGADIMYTGTVDCWKKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV

Protein Names:Recommended name: ADP/ATP translocase 1 Alternative name(s): 30 kDa calsequestrin-binding protein Short name= 30 kDa CSQ-binding protein ADP,ATP carrier protein 1 Adenine nucleotide translocator 1 Short name= ANT 1 Solute

Gene Names:Name:SLC25A4 Synonyms:ANT1

Expression Region:2-298

Sequence Info:Full length protein

View full details