Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrophosphate-energized proton pump 1(hppA1)

Recombinant Pyrophosphate-energized proton pump 1(hppA1)

SKU:CSB-CF835916RCT

Regular price ¥270,100 JPY
Regular price Sale price ¥270,100 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. trifolii

Uniprot NO.:Q93AS0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:GSAGLGALVLFAAYANDLSYFAANGDTYPYFKDIGEISFSLANPYVVAGLLFGGLIPYLF GGIAMTAVGKAASAIVEEVRRQFREKPGIMAGTEKPDYGRAVDLLTKAAIREMVIPSLLP VLAPLVVYFGVLLISGSKAFAFAALGAYLLAVIMNRVLVAICMTLVGSS

Protein Names:Recommended name: Pyrophosphate-energized proton pump 1 EC= 3.6.1.1 Alternative name(s): Membrane-bound proton-translocating pyrophosphatase 1 Pyrophosphate-energized inorganic pyrophosphatase 1 Short name= H(+)-PPase 1

Gene Names:Name:hppA1

Expression Region:1-169

Sequence Info:full length protein

View full details