
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: O57765
Gene Names: nadB
Organism: Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139)
AA Sequence: MMEMRVGIVGGGLAGLTAAIALAEKGFDVSIIGPRSTDSNSYLAQAGIALPLLEGDSIRIHVLDTIKAGKYINDEEIVWNVISKSSEAHDFLTSHGVTFTGNELEGGHSYPRIFTIKSETGKHIIPILEKHARELDVNFIRGFVEEIGINNGKLAGVFLQGELLKFDAVVIAAGGFSGLYRFTAGVKNNIGLLIGDVALKGVPLRDMEFVQFHPTGFIGKRTYLITEAVRGAGAKLVTGDGERFVNELETRDIVARAIYMKMLEGKGVFLDARGIENFKDRFPYIYSVLRGEGINPEKDLIPITPVAHYTIGGISVDAFYRTRIKGLYAIGESACNGFHGANRLASNSLLECVVSGLEVARTISREKPKREVNDAPYSFNELGDVDSIREVLWNHAGIVRDEWSLREGLRKLKEIEVDERLKLVAKAVIISALKREESRGAHYRKDYPFMRKEFEHSSFFYPNV
Expression Region: 1-464aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
MW: 71.3 kDa
Alternative Name(s): Quinolinate synthase B
Relevance: Catalyzes the oxidation of L-aspartate to iminoaspartate.
Reference: "Complete sequence and gene organization of the genome of a hyper-thermophilic archaebacterium, Pyrococcus horikoshii OT3." Kawarabayasi Y., Sawada M., Horikawa H., Haikawa Y., Hino Y., Yamamoto S., Sekine M., Baba S., Kosugi H., Hosoyama A., Nagai Y., Sakai M., Ogura K., Otsuka R., Nakazawa H., Takamiya M., Ohfuku Y., Funahashi T. Kikuchi H. DNA Res. 5:55-76(1998)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Escherichia coli L-aspartate oxidase(nadB)
- Regular price
- ¥134,500 JPY
- Sale price
- ¥134,500 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Pyruvate dehydrogenase [ubiquinone](poxB),partial
- Regular price
- ¥158,000 JPY
- Sale price
- ¥158,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Pyruvate dehydrogenase [ubiquinone](poxB)
- Regular price
- ¥158,000 JPY
- Sale price
- ¥158,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Escherichia coli Pyruvate kinase I(pykF)
- Regular price
- ¥124,300 JPY
- Sale price
- ¥124,300 JPY
- Regular price
-
- Unit price
- per
Sold out