Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pyrobaculum aerophilum UPF0290 protein PAE0660(PAE0660)

Recombinant Pyrobaculum aerophilum UPF0290 protein PAE0660(PAE0660)

SKU:CSB-CF849510FHU

Regular price ¥269,400 JPY
Regular price Sale price ¥269,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827)

Uniprot NO.:Q8ZYR4

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MDLTVFFLLIWPPYVANGSAVFASRLKWRHPVDFGRNFIDGRRIFGDGKTYEGVAIGIAT GTVLGYFPNLVYHVIGVFDAFVLSASAVLGDLIGAFIKRRLCMPRGHPAFPLDQLDFLLT AFLVYSLFREIPVVYVLAAVVITPVIHRATNYVAYLLKLKKEPW

Protein Names:Recommended name: UPF0290 protein PAE0660

Gene Names:Ordered Locus Names:PAE0660

Expression Region:1-164

Sequence Info:full length protein

View full details