Gene Bio Systems
Recombinant Pyrenophora tritici-repentis Signal peptidase complex catalytic subunit sec11(sec11)
Recombinant Pyrenophora tritici-repentis Signal peptidase complex catalytic subunit sec11(sec11)
SKU:CSB-CF451192FHT
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pyrenophora tritici-repentis (strain Pt-1C-BFP) (Wheat tan spot fungus) (Drechslera tritici-repentis)
Uniprot NO.:B2WEL2
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLGIADMQPRQLAAQILNFALVLSTAFMMWKGLSVVSDSPSPIVVVLSGSMEPAFQRGDL LFLWNRGADTQVGEIVVYNVKGKDIPIVHRVVRRYGGGKTPLRLLTKGDNNLADDTELYA AGQSFLNRQEDVIGSVVGFIPFVGYVTILLSEHPWLKQVMLGLMGVMVVLQRE
Protein Names:Recommended name: Signal peptidase complex catalytic subunit sec11 EC= 3.4.21.89 Alternative name(s): Signal peptidase I
Gene Names:Name:sec11 ORF Names:PTRG_08585
Expression Region:1-173
Sequence Info:full length protein
