Skip to product information
1 of 1

Gene Bio Systems

Recombinant Putative lipoprotein lprH(lprH)

Recombinant Putative lipoprotein lprH(lprH)

SKU:CSB-CF353306MVZ

Regular price ¥276,000 JPY
Regular price Sale price ¥276,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Mycobacterium tuberculosis

Uniprot NO.:P65316

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:CTESVAGRAMRATDRSSGLPTSAKPARARDLLLQDGDRAPFGQVTQSRVGDSYFTSAVPP ECSAALLFKGSPLRPDGSSDHAEAAYNVTGPLPYAESVDVYTNVLNVHDVVWNGFRDVSH CRGDAVGVSRAGRSTPMRLRYFATLSDGVLVWTMSNPRWTCDYGLAVVPHAVLVLSACGF KPGFPMAEWASKRRAQLDSQV

Protein Names:Recommended name: Putative lipoprotein lprH

Gene Names:Name:lprH Ordered Locus Names:Rv1418, MT1461 ORF Names:MTCY21B4.36

Expression Region:28-228

Sequence Info:full length protein

View full details