Skip to product information
1 of 1

Gene Bio Systems

Recombinant Putative ABC transporter permease protein ORF1

Recombinant Putative ABC transporter permease protein ORF1

SKU:CSB-CF706621FNV

Regular price ¥282,200 JPY
Regular price Sale price ¥282,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Streptomyces antibioticus

Uniprot NO.:Q53683

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:IPRHPTLANVRQAFAEQPLAHAALNSLLVALATAAVTVLIATPMAYVMARHRTKAARAAT GWVVVSQAFPFVLLIIPLFLVLKRLRLIDSLTGLVLVYVVWSLPFALWMLAGHARAVPAE LEEAAAVDGAGRVRTLTSVTVPLLAPGIAATALFAFVTAWNEFFFALVLLKSPHRQTLPV VLTHFIGAEGVPTSPAGAAAFLATLPSLAFFALVQRRITSGLLTGAVKN

Protein Names:Recommended name: Putative ABC transporter permease protein ORF1

Gene Names:

Expression Region:1-229

Sequence Info:full length protein

View full details