
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Psychrobacter sp. (strain PRwf-1)
Uniprot NO.:A5WG39
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MHLKPVETVQDTPTFATADPTILGPIPMEHGLILAAIIFAIGLCGVMVRRNFLFMLMSLE IMMSAAGLAFIVAGSHWLSADGQIMFIFILTLAAAEASLGLAILLQFYHRRGHLDVDSAN EMRG
Protein Names:Recommended name: NADH-quinone oxidoreductase subunit K EC= 1.6.99.5 Alternative name(s): NADH dehydrogenase I subunit K NDH-1 subunit K
Gene Names:Name:nuoK Ordered Locus Names:PsycPRwf_1690
Expression Region:1-124
Sequence Info:full length protein
You may also like
-
Recombinant Psychrobacter sp. NADH-quinone oxidoreductase subunit A(nuoA)
- Regular price
- ¥232,000 JPY
- Sale price
- ¥232,000 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Psychrobacter arcticus NADH-quinone oxidoreductase subunit K(nuoK)
- Regular price
- ¥219,900 JPY
- Sale price
- ¥219,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Psychrobacter cryohalolentis NADH-quinone oxidoreductase subunit K(nuoK)
- Regular price
- ¥219,900 JPY
- Sale price
- ¥219,900 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Psychrobacter cryohalolentis NADH-quinone oxidoreductase subunit A(nuoA)
- Regular price
- ¥231,200 JPY
- Sale price
- ¥231,200 JPY
- Regular price
-
- Unit price
- per
Sold out