Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas syringae pv. phaseolicola Probable intracellular septation protein A(PSPPH_3544)

Recombinant Pseudomonas syringae pv. phaseolicola Probable intracellular septation protein A(PSPPH_3544)

SKU:CSB-CF675323PAAT

Regular price ¥276,400 JPY
Regular price Sale price ¥276,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas syringae pv. phaseolicola (strain 1448A / Race 6)

Uniprot NO.:Q48FZ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQFIDFIPLLLFFIVYKTEPRAVDILGNTYMVGGIFSATAMLIISSVVVYGILYLKQRK LEKSQWLTLVACLVFGSLTLAFHSETFLKWKAPVVNWLFAVAFAGSHFIGDRPIIQRIMG HALTLPAAIWTRLNIAWIVFFLFCGAANLYVAFTYQEFWVDFKVFGSLGMTLIFLVGQGI YLSRHLHDTAPNTTKSED

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:PSPPH_3544

Expression Region:1-198

Sequence Info:full length protein

View full details