
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Pseudomonas putida (strain F1 / ATCC 700007)
Uniprot NO.:A5WAE0
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MLSTLIRRLSRALLWFVAGSIVLVLVFRWVPPPGTALMVERKVQSWVNGEPIDLQRDWEP WENISDELKVAVIAGEDQKFANHWGFDLPAIQAALAHNERGGNIRGASTLTQQVAKNLFL WSGRSWFRKGLEAWFTALIELFWSKERILEVYLNSAEWGKGVFGAQAAARYHFGVDASRL SRQQAAQLAAVLPSPIKWSASRPSAYVASRAGWIRRQMSQLGGPSYLMQLDSSRKL
Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.-
Gene Names:Name:mtgA Ordered Locus Names:Pput_4980
Expression Region:1-236
Sequence Info:full length protein
You may also like
-
Recombinant Pseudomonas putida Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)
- Regular price
- ¥181,600 JPY
- Sale price
- ¥181,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pseudomonas putida Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)
- Regular price
- ¥181,600 JPY
- Sale price
- ¥181,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pseudomonas putida Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)
- Regular price
- ¥181,600 JPY
- Sale price
- ¥181,600 JPY
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Pseudomonas entomophila Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)
- Regular price
- ¥181,600 JPY
- Sale price
- ¥181,600 JPY
- Regular price
-
- Unit price
- per
Sold out