Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas phage phi6 Fusion protein P6(P6)

Recombinant Pseudomonas phage phi6 Fusion protein P6(P6)

SKU:CSB-CF320830PUV

Regular price ¥270,000 JPY
Regular price Sale price ¥270,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas phage phi6 (Bacteriophage phi-6)

Uniprot NO.:P11128

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:SIFSSLFKVIKKVISKVVATLKKIFKKIWPLLLIVAIIYFAPYLAGFFTSAGFTGIGGIF SSIATTITPTLTSFLSTAWSGVGSLASTAWSGFQSLGMGTQLAVVSGAAALIAPEETAQL VTEIGTTVGDIAGTIIGGVAKALPGWIWIAAGGLAVWALWPSSDSKE

Protein Names:Recommended name: Fusion protein P6

Gene Names:Name:P6

Expression Region:2-168

Sequence Info:full length protein

View full details