Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas phage Pf1 Head virion protein G6P(VI)

Recombinant Pseudomonas phage Pf1 Head virion protein G6P(VI)

SKU:CSB-CF658498PUT

Regular price ¥265,600 JPY
Regular price Sale price ¥265,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas phage Pf1 (Bacteriophage Pf1)

Uniprot NO.:Q38066

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEWLSGFLDQIIAFFQWIWDFFAQGIYDFVRDGLVVATKASMYAALQTLILLIDVSYTAA RELIDSLGVPQMIRSMYAALPGPIAAGLAFFGVPQALNIIMGRGGDALLHALRAVHWEVI RVDQDPSRPQWLLQNLRRDPG

Protein Names:Recommended name: Head virion protein G6P Alternative name(s): Coat protein D G6P

Gene Names:Name:VI

Expression Region:1-141

Sequence Info:full length protein

View full details