Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas fluorescens Probable intracellular septation protein A(PFL_1596)

Recombinant Pseudomonas fluorescens Probable intracellular septation protein A(PFL_1596)

SKU:CSB-CF679350PAAW

Regular price ¥271,400 JPY
Regular price Sale price ¥271,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477)

Uniprot NO.:Q4KGB1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQFIDFIPLFLFFIVYKIDPRVVDLAGHEVTLGGIYSATAVLIISSLVVYGALFISQRK LEKSQWLTLIACLVFGSLTLAFHSETFLKWKAPVVNWLFALAFIGSHFVGDRLLIKRIMG HALTLPDPVWTRLNIAWIAFFLFCGAANLFVAFTFQSIWVDFKVFGSLGMTVLFLVGQGI YLSRHLHDADPTTPKTED

Protein Names:Recommended name: Probable intracellular septation protein A

Gene Names:Ordered Locus Names:PFL_1596

Expression Region:1-198

Sequence Info:full length protein

View full details