Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas fluorescens Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

Recombinant Pseudomonas fluorescens Monofunctional biosynthetic peptidoglycan transglycosylase(mtgA)

SKU:CSB-CF668494PAAQ

Regular price ¥246,500 JPY
Regular price Sale price ¥246,500 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas fluorescens (strain Pf0-1)

Uniprot NO.:Q3K584

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MLRLFLRRFTKALLWFAGGSVLLVLVFRFVPPPGTALMVERKIESWVDGEPIDLQRTWKP WDEISDDLKVAVIAGEDQKFPEHWGFDLSAIKAALAHNELGGSIRGASTLSQQVSKNLFL WSGRSYLRKGLEAWFTALIEVFWPKQRILEVYLNSVEWDDGVFGAEAAARHHFGVGARSL SRQQASYLAAVLPNPRVWSASHPTAYVSRRAGWIRQQMSQLGGDSYLLTLNDSRRAPWAQ

Protein Names:Recommended name: Monofunctional biosynthetic peptidoglycan transglycosylase Short name= Monofunctional TGase EC= 2.4.2.-

Gene Names:Name:mtgA Ordered Locus Names:Pfl01_5333

Expression Region:1-240

Sequence Info:full length protein

View full details