Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas fluorescens Disulfide bond formation protein B 1(dsbB1)

Recombinant Pseudomonas fluorescens Disulfide bond formation protein B 1(dsbB1)

SKU:CSB-CF659368PAAQ

Regular price ¥270,300 JPY
Regular price Sale price ¥270,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas fluorescens (strain Pf0-1)

Uniprot NO.:Q3K767

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MSEETIRLGRERRYLVLLGIICLALIGGALYMQIVLGEAPCPLCILQRYALLLIALFAFI GAAMRTRRSITVFEVLVVICAIAGAGVAGHHVYTQFYPAVSCGIDVLQPIVDDLPLAKIF PLGFQVDGFCSTPYPPILGLSLAQWALVAFVLVVILVPLLTSRNRKALR

Protein Names:Recommended name: Disulfide bond formation protein B 1 Alternative name(s): Disulfide oxidoreductase 1

Gene Names:Name:dsbB1 Ordered Locus Names:Pfl01_4650

Expression Region:1-169

Sequence Info:full length protein

View full details