Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas entomophila UPF0114 protein PSEEN0819(PSEEN0819)

Recombinant Pseudomonas entomophila UPF0114 protein PSEEN0819(PSEEN0819)

SKU:CSB-CF626257PAAK

Regular price ¥269,200 JPY
Regular price Sale price ¥269,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas entomophila (strain L48)

Uniprot NO.:Q1IF21

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERILENAMYASRWLLAPIYFGLSLGLLALALKFFQEIIHVLPNVFTLAEADLVLVILSL IDMSLVGGLLVMVMISGYENFVSQLDIDDSKEKLSWLGKMDSSSLKMKVAASIVAISSIH LLRVFMDAQNISTDYLMWYVIIHMTFVVSAFVMGYLDRITKH

Protein Names:Recommended name: UPF0114 protein PSEEN0819

Gene Names:Ordered Locus Names:PSEEN0819

Expression Region:1-162

Sequence Info:full length protein

View full details