Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa UPF0114 protein PSPA7_5214 (PSPA7_5214)

Recombinant Pseudomonas aeruginosa UPF0114 protein PSPA7_5214 (PSPA7_5214)

SKU:CSB-CF413577PZL

Regular price ¥270,300 JPY
Regular price Sale price ¥270,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain PA7)

Uniprot NO.:A6VBW1

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MERFFENAMYASRWLLAPIYMGLSLALLALTIKFFQEIFHVIPNIFAMAEADLILVLLSL IDMALVGGLLVMVMISGYENFVSQLDIDEGKEKLNWLGKMDSGSLKNKVAASIVAISSIH LLRIFMDAKNVPDNKLMWYVIIHMTFVLSAFAMGYLDKQTRH

Protein Names:Recommended name: UPF0114 protein PSPA7_5214

Gene Names:Ordered Locus Names:PSPA7_5214

Expression Region:1-162

Sequence Info:full length protein

View full details