Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa UPF0060 membrane protein PA14_21660 (PA14_21660)

Recombinant Pseudomonas aeruginosa UPF0060 membrane protein PA14_21660 (PA14_21660)

SKU:CSB-CF311677PUC

Regular price ¥260,300 JPY
Regular price Sale price ¥260,300 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain UCBPP-PA14)

Uniprot NO.:Q02QA7

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MINYLWFVLAAFCEIAGCYAFYLWLRLGKSALWVLPGLLSLTLFALLLTRVEASYAGRAY AAYGGIYVAASLFWLAFVERSRPLWSDWLGVALCVVGASVVLFGPRLSQ

Protein Names:Recommended name: UPF0060 membrane protein PA14_21660

Gene Names:Ordered Locus Names:PA14_21660

Expression Region:1-109

Sequence Info:full length protein

View full details