Recombinant Pseudomonas aeruginosa Lysyl endopeptidase(prpL)

Recombinant Pseudomonas aeruginosa Lysyl endopeptidase(prpL)

CSB-EP875877EZX
Regular price
¥123,200 JPY
Sale price
¥123,200 JPY
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: prpL

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Delivery time: 3-7 business days

Uniprot ID: Q9HWK6

AA Sequence: AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 212-462aa

Protein length: Full Length

MW: 42.4 kDa

Alternative Name(s): Protease IVPvdS-regulated endoprotease

Relevance: Lysine-specific endoprotease . Involved in corneal virulence.

Reference: Identification of the active site residues of Pseudomonas aeruginosa protease IV. Importance of enzyme activity in autoprocessing and activation.Traidej M., Marquart M.E., Caballero A.R., Thibodeaux B.A., O'Callaghan R.J.J. Biol. Chem. 278:2549-2553(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share