Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa Exoenzyme S synthesis protein C(exsC)

Recombinant Pseudomonas aeruginosa Exoenzyme S synthesis protein C(exsC)

SKU:CSB-CF335254EZX

Regular price ¥261,600 JPY
Regular price Sale price ¥261,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Uniprot NO.:P26995

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:LDEEGMASLLFDEQVGVTLLLLAERERLLLEADVAGIDVLGEGIFRQLASFNRHWHRFDL HFGFDELTGKVQLYAQILAAQLTLECFEATLANLLDHAEFWQRLLPCDSDREAVAAVGMR V

Protein Names:Recommended name: Exoenzyme S synthesis protein C

Gene Names:Name:exsC Ordered Locus Names:PA1710

Expression Region:25-145

Sequence Info:full length protein

View full details