Skip to product information
1 of 1

Gene Bio Systems

Recombinant Pseudomonas aeruginosa Aquaporin Z(aqpZ)

Recombinant Pseudomonas aeruginosa Aquaporin Z(aqpZ)

SKU:CSB-CF867359EZX

Regular price ¥282,200 JPY
Regular price Sale price ¥282,200 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Uniprot NO.:Q9HWZ3

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MKQYGAEFFGTFWLVLGGCGSAVLAAGVPELGIGYLGVALAFGLSVLTMAYAIGPISGAH LNPAVSVGLWVGGRFPASQLLPYVVAQVLGGLAAGGVLYLIASGKAGFDLAAGFASNGYG EHSPGGYSLQAALVSEVVLTGMFLLIILGATSKRAPQGFAPIAIGLTLTLIHLISIPVTN TSVNPARSTAVALYVGDWAVSQLWLFWVAPILGAVLGALAYRLIGDKND

Protein Names:Recommended name: Aquaporin Z

Gene Names:Name:aqpZ Ordered Locus Names:PA4034

Expression Region:1-229

Sequence Info:full length protein

View full details