Gene Bio Systems
Recombinant Proteus mirabilis UPF0208 membrane protein PMI1770 (PMI1770)
Recombinant Proteus mirabilis UPF0208 membrane protein PMI1770 (PMI1770)
SKU:CSB-CF461510EYZ
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Proteus mirabilis (strain HI4320)
Uniprot NO.:B4EZD8
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MNEPTVTPPGFFKKLRLGNEYLKTWPVEKQLAPVFPENRMIKATRFGIRYMPPIAIFTLT WQIALGGDLGPAITTALFACSLPMQGLWWLGKRAATPLPAVLLNWFYEIREKFEQAGIAL APVEKTPTYLSLAHLLKRAFKQLDRSFLDDV
Protein Names:Recommended name: UPF0208 membrane protein PMI1770
Gene Names:Ordered Locus Names:PMI1770
Expression Region:1-151
Sequence Info:full length protein
