Skip to product information
1 of 1

Gene Bio Systems

Recombinant Protein hupE(hupE)

Recombinant Protein hupE(hupE)

SKU:CSB-CF333277RKR

Regular price ¥268,600 JPY
Regular price Sale price ¥268,600 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Rhizobium leguminosarum bv. viciae

Uniprot NO.:P27650

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:HVGLHADGTLAGLNHPFSGLDHILAMVAVGFWASTLGGKAVWIVPSAFVIVMAGGGVLGI EGIALPMVETAIALTVAMLGLLVAFEVKIPTPVAAIVVGICALFHGHVHGIELPTMSNAT GYVAGFLAATVILHVLGIGLASLRFGKAGQVVARVAGGAVALAGAALLVG

Protein Names:Recommended name: Protein hupE

Gene Names:Name:hupE

Expression Region:22-191

Sequence Info:full length protein

View full details