Skip to product information
1 of 1

Gene Bio Systems

Recombinant Probable Ni-Fe-hydrogenase B-type cytochrome subunit(hupZ)

Recombinant Probable Ni-Fe-hydrogenase B-type cytochrome subunit(hupZ)

SKU:CSB-CF670407DPU

Regular price ¥246,000 JPY
Regular price Sale price ¥246,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Azotobacter chroococcum mcd 1

Uniprot NO.:Q43953

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MALEKSLETGDGQEKVRKQTAVYVYEAPLRLWHWVTALSIVVLGVTGYFIGAPLPTMPGE AMDNYLMGYIRFAHFAAGYVLAIGFLGRVYWAFVGNHHARELFLVPVHRKAWWKELWHEV RWYLFLEKVPKKYIGHNPLGQLAMFCFFVIGAVFMSVTGFALYAEGLGQGSWADRLFGWV IPLFGQSQDVHTWHHLGMWYLVVFVMIHVYLAAREDIVSRQSLISTMVGGWRMFKDDRPD

Protein Names:Recommended name: Probable Ni/Fe-hydrogenase B-type cytochrome subunit

Gene Names:Name:hupZ

Expression Region:1-240

Sequence Info:full length protein

View full details