Skip to product information
1 of 1

Gene Bio Systems

Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3(dpm-3)

Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3(dpm-3)

SKU:CSB-CF893622CXY

Regular price ¥222,000 JPY
Regular price Sale price ¥222,000 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available. Please Inquire.

Product Type:Recombinant Protein

Species:Caenorhabditis elegans

Uniprot NO.:Q9XVV5

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MVSQLVTYSAHVILFVLVWLLAYTDVVPVLSYLPECLHCLVNYAPFFAVLFLGIYAVFNV VYGVATFNDCAEAKVELLGEIKEAREELKRKRIID

Protein Names:Recommended name: Probable dolichol-phosphate mannosyltransferase subunit 3 Alternative name(s): DPM synthase complex subunit 3 Dolichol-phosphate mannose synthase subunit 3 Dolichyl-phosphate beta-D-mannosyltransferase subunit 3 Manno

Gene Names:Name:dpm-3 ORF Names:F28D1.11

Expression Region:1-95

Sequence Info:full length protein

View full details