Gene Bio Systems
Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3(dpm-3)
Recombinant Probable dolichol-phosphate mannosyltransferase subunit 3(dpm-3)
SKU:CSB-CF428187CXX
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Caenorhabditis briggsae
Uniprot NO.:A8WUS5
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MASQLIIYSAHVVLLVLVWLLAYTEVVPVLSYIPECAHCLVYYIYAAFNVIYGVATFNDC AEAKVELLQEIKQARAELKQKRIID
Protein Names:Recommended name: Probable dolichol-phosphate mannosyltransferase subunit 3 Alternative name(s): DPM synthase complex subunit 3 Dolichol-phosphate mannose synthase subunit 3 Dolichyl-phosphate beta-D-mannosyltransferase subunit 3 Manno
Gene Names:Name:dpm-3 ORF Names:CBG03325
Expression Region:1-85
Sequence Info:full length protein
