Gene Bio Systems
Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4(GP4)
Recombinant Porcine reproductive and respiratory syndrome virus Glycoprotein 4(GP4)
SKU:CSB-CF312007PQC
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Porcine reproductive and respiratory syndrome virus (strain Lelystad) (PRRSV)
Uniprot NO.:Q04568
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:CKPCFSTHLSDIETNTTAAAGFMVLQDINCFRPHGVSAAQEKISFGKSSQCREAVGTPQY ITITANVTDESYLYNADLLMLSACLFYASEMSEKGFKVIFGNVSGVVSACVNFTDYVAHV TQHTQQHHLVIDHIRLLHFLTPSAMRWATTIACLFAILLAI
Protein Names:Recommended name: Glycoprotein 4 Short name= Protein GP4
Gene Names:Name:GP4 ORF Names:4
Expression Region:23-183
Sequence Info:full length protein
