Skip to product information
1 of 1

Gene Bio Systems

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_834139 (POPTRDRAFT_834139)

Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_834139 (POPTRDRAFT_834139)

SKU:CSB-CF496206EXS

Regular price ¥276,400 JPY
Regular price Sale price ¥276,400 JPY
Sale Sold out
Shipping calculated at checkout.

Size:50 ug. Other sizes are also available.

Product Type:Recombinant Protein

Species:Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)

Uniprot NO.:B9I0G0

Tag Info:The tag type will be determined during production process.

Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein

Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

AA Sequence:MEKRDKGSSPMATMMGSRDENEDVENTTRTAETMLRLVPMALCVSALVVMLKNTQTNDYG SLSYSDLGAFRYLVHVNGICAGYSLLSAVIVAMPRASTMPRAWAFFLLDQVLTYVILAAG TVSTEVLYLASKGDTTITWSEACVSFGGFCHKALISIVITFVVVICYAALSLLSSYKLFS KYDSPVLTYPGKGIEIATFHG

Protein Names:Recommended name: CASP-like protein POPTRDRAFT_834139

Gene Names:ORF Names:POPTRDRAFT_834139

Expression Region:1-201

Sequence Info:full length protein

View full details