Gene Bio Systems
Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_758901 (POPTRDRAFT_758901)
Recombinant Populus trichocarpa CASP-like protein POPTRDRAFT_758901 (POPTRDRAFT_758901)
SKU:CSB-CF495253EXS
Couldn't load pickup availability
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Populus trichocarpa (Western balsam poplar) (Populus balsamifera subsp. trichocarpa)
Uniprot NO.:B9H2V1
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MAKIKKIFTNFLRLLALAATVVAIVFMVTSHDSAQVLNLTFTVKYSNTPVFKYFVIAEAI AGGYIVISILLSFKSLFWRLLVILDMVTAVLLTSSISAALAIAQVGKKGNTHAGWLPVCE QVPDFCDQVTIALIAGFAAAIIYFVLLLCSLYVVLSPIFVVTP
Protein Names:Recommended name: CASP-like protein POPTRDRAFT_758901
Gene Names:ORF Names:POPTRDRAFT_758901
Expression Region:1-163
Sequence Info:full length protein
